Lineage for d1r9ha_ (1r9h A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941417Protein FKB-6, N-terminal domain [102864] (1 species)
  7. 2941418Species Nematode (Caenorhabditis elegans) [TaxId:6239] [102865] (1 PDB entry)
  8. 2941419Domain d1r9ha_: 1r9h A: [97260]

Details for d1r9ha_

PDB Entry: 1r9h (more details), 1.8 Å

PDB Description: structural genomics of c.elegans: fkbp-type peptidylprolyl isomerase
PDB Compounds: (A:) FK506 Binding protein family

SCOPe Domain Sequences for d1r9ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
kiditpkkdggvlklikkegqgvvkpttgttvkvhyvgtlengtkfdssrdrgdqfsfnl
grgnvikgwdlgvatmtkgevaeftirsdygygdagsppkipggatlifevelfewsa

SCOPe Domain Coordinates for d1r9ha_:

Click to download the PDB-style file with coordinates for d1r9ha_.
(The format of our PDB-style files is described here.)

Timeline for d1r9ha_: