Lineage for d1r6wa2 (1r6w A:-2-99)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
C-terminal domain is beta/alpha-barrel
Protein O-succinylbenzoate synthase [54834] (1 species) Species Escherichia coli [TaxId:562] [54835] (4 PDB entries) 
Domain d1r6wa2: 1r6w A:-2-99 [97166]
Other proteins in same PDB: d1r6wa1
complexed with 164, mg; mutant
Details for d1r6wa2
PDB Entry: 1r6w (more details), 1.62 Å
PDB Description: crystal structure of the k133r mutant of o-succinylbenzoate synthase (osbs) from escherichia coli. complex with shchc
PDB Compounds: (A:) o-succinylbenzoate synthaseSCOPe Domain Sequences for d1r6wa2:
Sequence, based on SEQRES records: (download)
>d1r6wa2 d.54.1.1 (A:-2-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
shmrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetwee
aqsvllawvnnwlagdcelpqmpsvafgvscalaeltdtlp
Sequence, based on observed residues (ATOM records): (download)
>d1r6wa2 d.54.1.1 (A:-2-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
shmrsaqvyrwqipmdagvvldrrlktrdglyvclregeregwgeisplpgfsqetweea
qsvllawvnnwlagdcelpqmpsvafgvscalaeltdtlp
SCOPe Domain Coordinates for d1r6wa2:
Click to download the PDB-style file with coordinates for d1r6wa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r6wa2:
- d1r6wa2 first appeared in SCOP 1.67
- d1r6wa2 appears in SCOPe 2.04
- d1r6wa2 appears in SCOPe 2.06
- d1r6wa2 appears in the current release, SCOPe 2.08
View in 3D
