Lineage for d1r2ua_ (1r2u A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1734275Protein Troponin C [47503] (6 species)
  7. 1734337Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [109819] (2 PDB entries)
    Uniprot Q7ZZB9 1-89
  8. 1734338Domain d1r2ua_: 1r2u A: [104783]
    complexed with ca

Details for d1r2ua_

PDB Entry: 1r2u (more details)

PDB Description: nmr structure of the n domain of trout cardiac troponin c at 30 c
PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1r2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2ua_ a.39.1.5 (A:) Troponin C {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
mndiykaaveqltdeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

SCOPe Domain Coordinates for d1r2ua_:

Click to download the PDB-style file with coordinates for d1r2ua_.
(The format of our PDB-style files is described here.)

Timeline for d1r2ua_: