Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Metal-sensing transcriptional repressor CzrA [109664] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [109665] (3 PDB entries) Uniprot O85142 |
Domain d1r1ub_: 1r1u B: [104772] |
PDB Entry: 1r1u (more details), 2 Å
SCOPe Domain Sequences for d1r1ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1ub_ a.4.5.5 (B:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl vkakrqgqsmiyslddihvatmlkqaihhanhp
Timeline for d1r1ub_: