Lineage for d1qz3a_ (1qz3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1616235Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1616236Protein Carboxylesterase [53488] (3 species)
    bacterial homologue of human hormone sensitive lipase
  7. 1616237Species Alicyclobacillus acidocaldarius [TaxId:405212] [53490] (4 PDB entries)
    Uniprot Q7SIG1
  8. 1616240Domain d1qz3a_: 1qz3 A: [96612]
    complexed with hds; mutant

Details for d1qz3a_

PDB Entry: 1qz3 (more details), 2.3 Å

PDB Description: crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate
PDB Compounds: (A:) carboxylesterase est2

SCOPe Domain Sequences for d1qz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz3a_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
pldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdlpgrtlk
vrmyrpegveppypalvyyhgggwvvgdlethdpvcrvlakdgravvfsvdyrlapehkf
paavedaydalqwiaeraadfhldpariavggdsaggnlaavtsilakerggpalafqll
iypstgydpahppasieenaegylltggmslwfldqylnsleelthpwfspvlypdlsgl
ppayiataqydplrdvgklyaealnkagvkveienfedlihgfaqfyslspgatkalvri
aeklrdala

SCOPe Domain Coordinates for d1qz3a_:

Click to download the PDB-style file with coordinates for d1qz3a_.
(The format of our PDB-style files is described here.)

Timeline for d1qz3a_: