Lineage for d1qyra_ (1qyr A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) 
Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins) 
Protein High level kasugamycin resistance protein KsgA [110662] (1 species) Species Escherichia coli [TaxId:562] [110663] (1 PDB entry)
Uniprot P06992
Domain d1qyra_: 1qyr A: [104657]
Details for d1qyra_
PDB Entry: 1qyr (more details), 2.1 Å
PDB Description: 2.1 angstrom crystal structure of ksga: a universally conserved adenosine dimethyltransferase
PDB Compounds: (A:) High level Kasugamycin resistance proteinSCOPe Domain Sequences for d1qyra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]}
qnflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaarlq
thpflgpkltiyqqdamtfnfgelaekmgqplrvfgnlpynistplmfhlfsytdaiadm
hfmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrlvp
hatmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisvaq
ycqmanylaena
SCOPe Domain Coordinates for d1qyra_:
Click to download the PDB-style file with coordinates for d1qyra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qyra_:
- d1qyra_ first appeared in SCOP 1.69
- d1qyra_ appears in SCOPe 2.05
- d1qyra_ appears in SCOPe 2.07
- d1qyra_ appears in the current release, SCOPe 2.08
View in 3D
