Lineage for d1qsee2 (1qse E:119-246)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029022Protein T-cell antigen receptor [49125] (7 species)
  7. 2029060Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)
  8. 2029090Domain d1qsee2: 1qse E:119-246 [21577]
    Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb_, d1qsed1, d1qsee1

Details for d1qsee2

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r
PDB Compounds: (E:) PROTEIN (hman T-Cell receptor)

SCOPe Domain Sequences for d1qsee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsee2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d1qsee2:

Click to download the PDB-style file with coordinates for d1qsee2.
(The format of our PDB-style files is described here.)

Timeline for d1qsee2: