SCOPe 2.06: Domain d1qsed1: 1qse D:1-117

Lineage for d1qsed1 (1qse D:1-117)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
Domain d1qsed1: 1qse D:1-117 [20625]
Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb_, d1qsed2, d1qsee2

Details for d1qsed1

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r

PDB Compounds: (D:) PROTEIN (hman T-Cell receptor)

SCOPe Domain Sequences for d1qsed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsed1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

SCOPe Domain Coordinates for d1qsed1:

Click to download the PDB-style file with coordinates for d1qsed1.
(The format of our PDB-style files is described here.)

Timeline for d1qsed1: