Lineage for d1qsed1 (1qse D:1-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2741897Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
  8. 2741916Domain d1qsed1: 1qse D:1-117 [20625]
    Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb_, d1qsed2, d1qsee2

Details for d1qsed1

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r
PDB Compounds: (D:) PROTEIN (hman T-Cell receptor)

SCOPe Domain Sequences for d1qsed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsed1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

SCOPe Domain Coordinates for d1qsed1:

Click to download the PDB-style file with coordinates for d1qsed1.
(The format of our PDB-style files is described here.)

Timeline for d1qsed1: