Lineage for d1qrya_ (1qry A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981565Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1981738Protein VND/NK-2 protein [46724] (1 species)
  7. 1981739Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries)
  8. 1981743Domain d1qrya_: 1qry A: [16016]

Details for d1qrya_

PDB Entry: 1qry (more details)

PDB Description: homeobox protein vnd (ventral nervous system defective protein)
PDB Compounds: (A:) protein (homeobox ventral nervous system defective protein)

SCOPe Domain Sequences for d1qrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrya_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gshmsdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehltslirltptqvkiwf
qnhryktkraqnekgyeghp

SCOPe Domain Coordinates for d1qrya_:

Click to download the PDB-style file with coordinates for d1qrya_.
(The format of our PDB-style files is described here.)

Timeline for d1qrya_: