Lineage for d1qrnd1 (1qrn D:1-117)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified speciesSpecies Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries) 
Domain d1qrnd1: 1qrn D:1-117 [20624]
Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb2, d1qrnb3, d1qrnd2, d1qrne2
Details for d1qrnd1
PDB Entry: 1qrn (more details), 2.8 Å
PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a
PDB Compounds: (D:) T-cell receptor, alpha chainSCOPe Domain Sequences for d1qrnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrnd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd
SCOPe Domain Coordinates for d1qrnd1:
Click to download the PDB-style file with coordinates for d1qrnd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qrnd1:
View in 3D
