Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of family B DNA polymerases [53125] (8 species) elaborated with additional structures and the N-terminal subdomain |
Species Desulfurococcus tok [TaxId:108142] [53130] (2 PDB entries) additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold |
Domain d1qqca1: 1qqc A:1-347 [33724] Other proteins in same PDB: d1qqca2 complexed with mg, so4 |
PDB Entry: 1qqc (more details), 2.6 Å
SCOPe Domain Sequences for d1qqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqca1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Desulfurococcus tok [TaxId: 108142]} mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry lidrglipmegdeelrmlafdietlyhegeefgegpilmisyadeegarvitwknidlpy vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpkekvyaeeiarawe sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrs
Timeline for d1qqca1: