Lineage for d1qovh1 (1qov H:36-250)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.41: PRC-barrel domain [50345] (1 superfamily)
core: barrel, partly opened; n*=5, S*=8; meanderSuperfamily b.41.1: PRC-barrel domain [50346] (5 families) 
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) Protein Photosynthetic reaction centre [50348] (4 species) 
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries)
Uniprot P11846
Domain d1qovh1: 1qov H:36-250 [25464]
Other proteins in same PDB: d1qovh2, d1qovl_, d1qovm_
complexed with bcl, bph, cdl, cl, fe2, spn, u10; mutant
Details for d1qovh1
PDB Entry: 1qov (more details), 2.1 Å
PDB Description: photosynthetic reaction center mutant with ala m260 replaced with trp (chain m, a260w)
PDB Compounds: (H:) photosynthetic reaction centerSCOPe Domain Sequences for d1qovh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qovh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks
SCOPe Domain Coordinates for d1qovh1:
Click to download the PDB-style file with coordinates for d1qovh1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qovh1:
- d1qovh1 first appeared (with stable ids) in SCOP 1.55
- d1qovh1 appears in SCOPe 2.05
- d1qovh1 appears in SCOPe 2.07
- d1qovh1 appears in the current release, SCOPe 2.08
View in 3D
