Lineage for d1qnra_ (1qnr A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819096Protein Beta-mannanase [51502] (4 species)
  7. 1819105Species Trichoderma reesei [TaxId:51453] [51504] (5 PDB entries)
  8. 1819106Domain d1qnra_: 1qnr A: [28834]
    complexed with gol, mab, nag, so4

Details for d1qnra_

PDB Entry: 1qnr (more details), 1.4 Å

PDB Description: the 3-d structure of a trichoderma reesei b-mannanase from glycoside hydrolase family 5
PDB Compounds: (A:) endo-1,4-b-d-mannanase

SCOPe Domain Sequences for d1qnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]}
assfvtisgtqfnidgkvgyfagtncywcsfltnhadvdstfshisssglkvvrvwgfnd
vntqpspgqiwfqklsatgstintgadglqtldyvvqsaeqhnlkliipfvnnwsdyggi
nayvnafggnattwytntaaqtqyrkyvqavvsryanstaifawelgneprcngcstdvi
vqwatsvsqyvksldsnhlvtlgdeglglstgdgaypytygegtdfaknvqiksldfgtf
hlypdswgtnytwgngwiqthaaaclaagkpcvfeeygaqqnpctneapwqttslttrgm
ggdmfwqwgdtfangaqsnsdpytvwynssnwqclvknhvdain

SCOPe Domain Coordinates for d1qnra_:

Click to download the PDB-style file with coordinates for d1qnra_.
(The format of our PDB-style files is described here.)

Timeline for d1qnra_: