Lineage for d1qm9a2 (1qm9 A:111-198)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724485Protein Polypyrimidine tract-binding protein [54950] (1 species)
  7. 724486Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
  8. 724493Domain d1qm9a2: 1qm9 A:111-198 [39208]
    RR3-RR4 tandem; representative structure

Details for d1qm9a2

PDB Entry: 1qm9 (more details)

PDB Description: nmr, representative structure
PDB Compounds: (A:) polypyrimidine tract-binding protein

SCOP Domain Sequences for d1qm9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm9a2 d.58.7.1 (A:111-198) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvseedlkvlfssnggvvkgfkffqkdrkmaliqmgsvee
avqalidlhnhdlgenhhlrvsfsksti

SCOP Domain Coordinates for d1qm9a2:

Click to download the PDB-style file with coordinates for d1qm9a2.
(The format of our PDB-style files is described here.)

Timeline for d1qm9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qm9a1