Lineage for d1qm9a1 (1qm9 A:1-110)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (68 proteins) 
Protein Polypyrimidine tract-binding protein [54950] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
Uniprot P26599 54-141, 177-284, 335-531
Domain d1qm9a1: 1qm9 A:1-110 [39207]
RR3-RR4 tandem; representative structure
Details for d1qm9a1
PDB Entry: 1qm9 (more details)
PDB Description: nmr, representative structure
PDB Compounds: (A:) polypyrimidine tract-binding proteinSCOPe Domain Sequences for d1qm9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qm9a1 d.58.7.1 (A:1-110) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
mgnsvllvsnlnpervtpqslfilfgvygdvqrvkilfnkkenalvqmadgnqaqlamsh
lnghklhgkpiritlskhqnvqlpregqedqgltkdygnsplhrfkkpgs
SCOPe Domain Coordinates for d1qm9a1:
Click to download the PDB-style file with coordinates for d1qm9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qm9a1:
- d1qm9a1 first appeared (with stable ids) in SCOP 1.55
- d1qm9a1 appears in SCOPe 2.02
- d1qm9a1 appears in SCOPe 2.04
- d1qm9a1 appears in the current release, SCOPe 2.08
View in 3D
