Lineage for d1qlla_ (1qll A:)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) Protein Snake phospholipase A2 [48624] (35 species) 
Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (3 PDB entries) 
Domain d1qlla_: 1qll A: [19556]
complexed with tda
Details for d1qlla_
PDB Entry: 1qll (more details), 2.04 Å
PDB Description: piratoxin-ii (prtx-ii) - a k49 pla2 from bothrops pirajai
PDB Compounds: (A:) phospholipase a2SCOPe Domain Sequences for d1qlla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlla_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk
c
SCOPe Domain Coordinates for d1qlla_:
Click to download the PDB-style file with coordinates for d1qlla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qlla_:
- d1qlla_ first appeared (with stable ids) in SCOP 1.55
- d1qlla_ appears in SCOP 1.75
- d1qlla_ appears in SCOPe 2.02
- d1qlla_ appears in the current release, SCOPe 2.08
View in 3D
