Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Transcriptional regulatory protein DctD, receiver domain [52184] (1 species) |
Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [52185] (3 PDB entries) |
Domain d1qkka_: 1qkk A: [31104] also includes a part of the linker region |
PDB Entry: 1qkk (more details), 1.7 Å
SCOPe Domain Sequences for d1qkka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} psvflidddrdlrkamqqtlelagftvssfasatealaglsadfagivisdirmpgmdgl alfrkilaldpdlpmilvtghgdipmavqaiqdgaydfiakpfaadrlvqsarraeekrr lvmenrslrraaeaaseglk
Timeline for d1qkka_: