Lineage for d1qkka_ (1qkk A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837956Protein Transcriptional regulatory protein DctD, receiver domain [52184] (1 species)
  7. 1837957Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [52185] (3 PDB entries)
  8. 1837958Domain d1qkka_: 1qkk A: [31104]
    also includes a part of the linker region

Details for d1qkka_

PDB Entry: 1qkk (more details), 1.7 Å

PDB Description: crystal structure of the receiver domain and linker region of dctd from sinorhizobium meliloti
PDB Compounds: (A:) c4-dicarboxylate transport transcriptional regulatory protein

SCOPe Domain Sequences for d1qkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
psvflidddrdlrkamqqtlelagftvssfasatealaglsadfagivisdirmpgmdgl
alfrkilaldpdlpmilvtghgdipmavqaiqdgaydfiakpfaadrlvqsarraeekrr
lvmenrslrraaeaaseglk

SCOPe Domain Coordinates for d1qkka_:

Click to download the PDB-style file with coordinates for d1qkka_.
(The format of our PDB-style files is described here.)

Timeline for d1qkka_: