Lineage for d1qfwb_ (1qfw B:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. Protein Gonadotropin B chain [63396] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [63398] (3 PDB entries)
  8. Domain d1qfwb_: 1qfw B: [44814]
    Other proteins in same PDB: d1qfwa_, d1qfwh1, d1qfwh2, d1qfwi1, d1qfwi2, d1qfwl_, d1qfwm_
    complexed with nag

Details for d1qfwb_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit
PDB Compounds: (B:) gonadotrophin beta subunit

SCOPe Domain Sequences for d1qfwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfwb_ g.17.1.4 (B:) Gonadotropin B chain {Human (Homo sapiens) [TaxId: 9606]}
keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd
vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcdd

SCOPe Domain Coordinates for d1qfwb_ are not available.

Timeline for d1qfwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qfwa_, d1qfwh1, d1qfwh2, d1qfwi1, d1qfwi2, d1qfwl_, d1qfwm_