Lineage for d1qe6d_ (1qe6 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929011Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 2929012Species Human (Homo sapiens) [TaxId:9606] [54120] (15 PDB entries)
  8. 2929024Domain d1qe6d_: 1qe6 D: [37362]
    complexed with so4

Details for d1qe6d_

PDB Entry: 1qe6 (more details), 2.35 Å

PDB Description: interleukin-8 with an added disulfide between residues 5 and 33 (l5c/h33c)
PDB Compounds: (D:) interleukin-8 variant

SCOPe Domain Sequences for d1qe6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qe6d_ d.9.1.1 (D:) Interleukin-8, IL-8 {Human (Homo sapiens) [TaxId: 9606]}
sakecrcqciktyskpfhpkfikelrviesgpccanteiivklsdgrelcldpkenwvqr
vvekflkraens

SCOPe Domain Coordinates for d1qe6d_:

Click to download the PDB-style file with coordinates for d1qe6d_.
(The format of our PDB-style files is described here.)

Timeline for d1qe6d_: