Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein Interleukin-8, IL-8 [54119] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54120] (15 PDB entries) |
Domain d1qe6d_: 1qe6 D: [37362] complexed with so4 |
PDB Entry: 1qe6 (more details), 2.35 Å
SCOPe Domain Sequences for d1qe6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qe6d_ d.9.1.1 (D:) Interleukin-8, IL-8 {Human (Homo sapiens) [TaxId: 9606]} sakecrcqciktyskpfhpkfikelrviesgpccanteiivklsdgrelcldpkenwvqr vvekflkraens
Timeline for d1qe6d_: