Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin B [54022] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [54025] (3 PDB entries) |
Domain d1qdqa_: 1qdq A: [37064] complexed with 074 |
PDB Entry: 1qdq (more details), 2.18 Å
SCOPe Domain Sequences for d1qdqa_:
Sequence, based on SEQRES records: (download)
>d1qdqa_ d.3.1.1 (A:) (Pro)cathepsin B {Cow (Bos taurus) [TaxId: 9913]} lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsngrvnvevsaedml tccggecgdgcnggepsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppct gegdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdf llyksgvyqhvsgeimgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhc gieseivagmpct
>d1qdqa_ d.3.1.1 (A:) (Pro)cathepsin B {Cow (Bos taurus) [TaxId: 9913]} lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsnvnvevsaedmltc cggecgdgcnggepsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppctge gdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdfll yksgvyqhvsgeimgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhcgi eseivagmpct
Timeline for d1qdqa_: