Lineage for d1q8zb_ (1q8z B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Sky1p [56148] (1 species)
CMGC group; Clk subfamily; serine/threonine kinaseSpecies Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries) 
Domain d1q8zb_: 1q8z B: [96237]
complexed with edo, moh, so4
Details for d1q8zb_
PDB Entry: 1q8z (more details), 2.35 Å
PDB Description: the apoenzyme structure of the yeast sr protein kinase, sky1p
PDB Compounds: (B:) SR protein kinaseSCOPe Domain Sequences for d1q8zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8zb_ d.144.1.7 (B:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaed
eikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkye
hrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgn
acwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsyt
kdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfsk
deakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwf
eevr
SCOPe Domain Coordinates for d1q8zb_:
Click to download the PDB-style file with coordinates for d1q8zb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q8zb_:
- d1q8zb_ first appeared in SCOP 1.67
- d1q8zb_ appears in SCOPe 2.02
- d1q8zb_ appears in SCOPe 2.04
- d1q8zb_ appears in the current release, SCOPe 2.08
View in 3D
