Lineage for d1q8fa_ (1q8f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903313Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2903314Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2903315Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
    automatically mapped to Pfam PF01156
  6. 2903342Protein Pyrimidine nucleoside hydrolase YeiK [102633] (1 species)
  7. 2903343Species Escherichia coli [TaxId:562] [102634] (3 PDB entries)
  8. 2903344Domain d1q8fa_: 1q8f A: [96203]
    complexed with ca, gol

Details for d1q8fa_

PDB Entry: 1q8f (more details), 1.7 Å

PDB Description: Crystal Structure of the E.coli pyrimidine nucleoside hydrolase yeiK
PDB Compounds: (A:) Pyrimidine nucleoside hydrolase

SCOPe Domain Sequences for d1q8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8fa_ c.70.1.1 (A:) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli [TaxId: 562]}
krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv
pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv
plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat
cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv
eecvrgyi

SCOPe Domain Coordinates for d1q8fa_:

Click to download the PDB-style file with coordinates for d1q8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1q8fa_: