Lineage for d1q5ya_ (1q5y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954103Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
    automatically mapped to Pfam PF08753
  6. 2954104Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 2954105Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)
  8. 2954106Domain d1q5ya_: 1q5y A: [95950]
    nickel-bound; C-terminal domain only
    complexed with edo, ni

Details for d1q5ya_

PDB Entry: 1q5y (more details), 1.4 Å

PDB Description: Nickel-Bound C-terminal Regulatory Domain of NikR
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d1q5ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5ya_ d.58.18.4 (A:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
tqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvq
hfaddviaqrgvrhghlqclpked

SCOPe Domain Coordinates for d1q5ya_:

Click to download the PDB-style file with coordinates for d1q5ya_.
(The format of our PDB-style files is described here.)

Timeline for d1q5ya_: