Lineage for d1q1jl2 (1q1j L:109-213)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries) 
Domain d1q1jl2: 1q1j L:109-213 [95586]
Other proteins in same PDB: d1q1jh1, d1q1jh2, d1q1ji1, d1q1ji2, d1q1jl1, d1q1jm1
part of anti HIV-1 Fab 447-52d
Details for d1q1jl2
PDB Entry: 1q1j (more details), 2.5 Å
PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide
PDB Compounds: (L:) Fab 447-52D, light chainSCOPe Domain Sequences for d1q1jl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1jl2 b.1.1.2 (L:109-213) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapte
SCOPe Domain Coordinates for d1q1jl2:
Click to download the PDB-style file with coordinates for d1q1jl2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q1jl2:
- d1q1jl2 first appeared in SCOP 1.67
- d1q1jl2 appears in SCOPe 2.06
- d1q1jl2 appears in the current release, SCOPe 2.08
View in 3D
