SCOP 1.73: Domain d1q1jh2: 1q1j H:114-227

Lineage for d1q1jh2 (1q1j H:114-227)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1q1jh2: 1q1j H:114-227 [95582]
Other proteins in same PDB: d1q1jh1, d1q1ji1, d1q1jl1, d1q1jl2, d1q1jm1, d1q1jm2

Details for d1q1jh2

PDB Entry: 1q1j (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide

PDB Compounds: (H:) Fab 447-52D, heavy chain

SCOP Domain Sequences for d1q1jh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1jh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel

SCOP Domain Coordinates for d1q1jh2:

Click to download the PDB-style file with coordinates for d1q1jh2.
(The format of our PDB-style files is described here.)

Timeline for d1q1jh2: