Lineage for d1q0oa2 (1q0o A:148-359)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1900969Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 1901058Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 1901072Species Brevibacterium fuscum [TaxId:47914] [89888] (15 PDB entries)
  8. 1901186Domain d1q0oa2: 1q0o A:148-359 [88352]
    full length protein
    complexed with fe

Details for d1q0oa2

PDB Entry: 1q0o (more details), 2.3 Å

PDB Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum (full length protein)
PDB Compounds: (A:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d1q0oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0oa2 d.32.1.3 (A:148-359) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqaskgf

SCOPe Domain Coordinates for d1q0oa2:

Click to download the PDB-style file with coordinates for d1q0oa2.
(The format of our PDB-style files is described here.)

Timeline for d1q0oa2:

1901186
d1q0oa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1q0oa1