Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Surfactant protein, lectin domain [56461] (3 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries) |
Domain d1pwba1: 1pwb A:235-355 [95212] Other proteins in same PDB: d1pwba2, d1pwbb2, d1pwbc2 complexed with ca, glc |
PDB Entry: 1pwb (more details), 1.4 Å
SCOPe Domain Sequences for d1pwba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d1pwba1:
View in 3D Domains from other chains: (mouse over for more information) d1pwbb1, d1pwbb2, d1pwbc1, d1pwbc2 |