Lineage for d1pwba1 (1pwb A:235-355)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682460Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 1682461Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries)
  8. 1682462Domain d1pwba1: 1pwb A:235-355 [95212]
    Other proteins in same PDB: d1pwba2, d1pwbb2, d1pwbc2
    complexed with ca, glc

Details for d1pwba1

PDB Entry: 1pwb (more details), 1.4 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d with maltose
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d1pwba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d1pwba1:

Click to download the PDB-style file with coordinates for d1pwba1.
(The format of our PDB-style files is described here.)

Timeline for d1pwba1: