Lineage for d1prxb_ (1prx B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) 
Protein 1-Cys peroxiredoxin [52909] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [52910] (3 PDB entries) 
Domain d1prxb_: 1prx B: [33077]
Details for d1prxb_
PDB Entry: 1prx (more details), 2 Å
PDB Description: horf6 a novel human peroxidase enzyme
PDB Compounds: (B:) horf6SCOPe Domain Sequences for d1prxb_:
Sequence, based on SEQRES records: (download)
>d1prxb_ c.47.1.10 (B:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]}
pgglllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapef
akrnvklialsidsvedhlawskdinaynseepteklpfpiiddrnrelaillgmldpae
kdekgmpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdw
kdgdsvmvlptipeeeakklfpkgvftkelpsgkkylrytpqp
Sequence, based on observed residues (ATOM records): (download)
>d1prxb_ c.47.1.10 (B:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]}
pgglllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapef
akrnvklialsidsvedhlawskdinaynseepteklpfpiiddrnrelaillgmldpae
mpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdwkdgds
vmvlptipeeeakklfpkgvftkelpsgkkylrytpqp
SCOPe Domain Coordinates for d1prxb_:
Click to download the PDB-style file with coordinates for d1prxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1prxb_:
- d1prxb_ first appeared (with stable ids) in SCOP 1.55
- d1prxb_ appears in SCOPe 2.07
View in 3D
