Lineage for d1prxa_ (1prx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877442Protein 1-Cys peroxiredoxin [52909] (3 species)
  7. 2877443Species Human (Homo sapiens) [TaxId:9606] [52910] (3 PDB entries)
  8. 2877444Domain d1prxa_: 1prx A: [33076]

Details for d1prxa_

PDB Entry: 1prx (more details), 2 Å

PDB Description: horf6 a novel human peroxidase enzyme
PDB Compounds: (A:) horf6

SCOPe Domain Sequences for d1prxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]}
lllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapefakr
nvklialsidsvedhlawskdinaynseepteklpfpiiddrnrelaillgmldpaekde
kgmpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdwkdg
dsvmvlptipeeeakklfpkgvftkelpsgkkylrytpqp

SCOPe Domain Coordinates for d1prxa_:

Click to download the PDB-style file with coordinates for d1prxa_.
(The format of our PDB-style files is described here.)

Timeline for d1prxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1prxb_