Lineage for d1prtc2 (1prt C:4-89)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (3 proteins)
automatically mapped to Pfam PF03440
Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species) Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries) 
Domain d1prtc2: 1prt C:4-89 [42426]
Other proteins in same PDB: d1prta_, d1prtb1, d1prtc1, d1prtd_, d1prte_, d1prtf_, d1prtg_, d1prth1, d1prti1, d1prtj_, d1prtk_, d1prtl_
Details for d1prtc2
PDB Entry: 1prt (more details), 2.9 Å
PDB Description: the crystal structure of pertussis toxin
PDB Compounds: (C:) pertussis toxin (subunit s3)SCOPe Domain Sequences for d1prtc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1prtc2 d.169.1.2 (C:4-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis [TaxId: 520]}
givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
gqayggiikdappgagfiyretfcit
SCOPe Domain Coordinates for d1prtc2:
Click to download the PDB-style file with coordinates for d1prtc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1prtc2:
- d1prtc2 first appeared (with stable ids) in SCOP 1.55
- d1prtc2 appears in SCOPe 2.07
View in 3D
