Lineage for d1prcc_ (1prc C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099891Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1099892Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1099990Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
    consists of four heme-binding repeats
  6. 1099991Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 1099992Species Rhodopseudomonas viridis [TaxId:1079] [48709] (15 PDB entries)
  8. 1100000Domain d1prcc_: 1prc C: [19674]
    Other proteins in same PDB: d1prch1, d1prch2, d1prcl_, d1prcm_
    complexed with bcb, bpb, fe, hem, lda, mq7, ns1, so4, uq1

Details for d1prcc_

PDB Entry: 1prc (more details), 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis
PDB Compounds: (C:) photosynthetic reaction center

SCOPe Domain Sequences for d1prcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpika

SCOPe Domain Coordinates for d1prcc_:

Click to download the PDB-style file with coordinates for d1prcc_.
(The format of our PDB-style files is described here.)

Timeline for d1prcc_: