Class a: All alpha proteins [46456] (284 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein) consists of four heme-binding repeats |
Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [48709] (15 PDB entries) |
Domain d1prcc_: 1prc C: [19674] Other proteins in same PDB: d1prch1, d1prch2, d1prcl_, d1prcm_ complexed with bcb, bpb, fe, hem, lda, mq7, ns1, so4, uq1 |
PDB Entry: 1prc (more details), 2.3 Å
SCOPe Domain Sequences for d1prcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]} cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea pqadcrtchqgvtkplfgasrlkdypelgpika
Timeline for d1prcc_:
View in 3D Domains from other chains: (mouse over for more information) d1prch1, d1prch2, d1prcl_, d1prcm_ |