Lineage for d1pkla3 (1pkl A:358-498)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 993924Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 993925Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 993926Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 993927Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 994015Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (3 PDB entries)
  8. 994016Domain d1pkla3: 1pkl A:358-498 [33134]
    Other proteins in same PDB: d1pkla1, d1pkla2, d1pklb1, d1pklb2, d1pklc1, d1pklc2, d1pkld1, d1pkld2, d1pkle1, d1pkle2, d1pklf1, d1pklf2, d1pklg1, d1pklg2, d1pklh1, d1pklh2
    complexed with so4

Details for d1pkla3

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase
PDB Compounds: (A:) protein (pyruvate kinase)

SCOPe Domain Sequences for d1pkla3:

Sequence, based on SEQRES records: (download)

>d1pkla3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

Sequence, based on observed residues (ATOM records): (download)

>d1pkla3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihaanqtrillve

SCOPe Domain Coordinates for d1pkla3:

Click to download the PDB-style file with coordinates for d1pkla3.
(The format of our PDB-style files is described here.)

Timeline for d1pkla3: