Lineage for d1pk2a_ (1pk2 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033340Protein Plasminogen [63400] (1 species)
  7. 3033341Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 3033374Domain d1pk2a_: 1pk2 A: [44641]
    kringle 2
    complexed with aca

Details for d1pk2a_

PDB Entry: 1pk2 (more details)

PDB Description: solution structure of the tissue-type plasminogen activator kringle 2 domain complexed to 6-aminohexanoic acid an antifibrinolytic drug
PDB Compounds: (A:) tissue-type plasminogen activator

SCOPe Domain Sequences for d1pk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk2a_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
segnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycr
npdgdakpwchvlknrrltweycdvpscst

SCOPe Domain Coordinates for d1pk2a_:

Click to download the PDB-style file with coordinates for d1pk2a_.
(The format of our PDB-style files is described here.)

Timeline for d1pk2a_: