Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein Envelope glycoprotein [49213] (5 species) |
Species Japanese encephalitis virus [TaxId:11072] [101527] (1 PDB entry) |
Domain d1pjwa_: 1pjw A: [94793] C-terminal domain only |
PDB Entry: 1pjw (more details)
SCOPe Domain Sequences for d1pjwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjwa_ b.1.18.4 (A:) Envelope glycoprotein {Japanese encephalitis virus [TaxId: 11072]} dklalkgttygmctekfsfaknpadtghgtvvielsysgsdgpckipivsvaslndmtpv grlvtvnpfvatssanskvlvemeppfgdsyivvgmgdkqinhhwhkagst
Timeline for d1pjwa_: