Lineage for d1phnb_ (1phn B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
binds a bilin chromophore
automatically mapped to Pfam PF00502
Protein Phycocyanin beta subunit [88940] (8 species) 
Species Red alga (Cyanidium caldarium) [TaxId:2771] [88941] (1 PDB entry) 
Domain d1phnb_: 1phn B: [15642]
Other proteins in same PDB: d1phna_
complexed with cyc, peb
Details for d1phnb_
PDB Entry: 1phn (more details), 1.65 Å
PDB Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution
PDB Compounds: (B:) phycocyaninSCOPe Domain Sequences for d1phnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phnb_ a.1.1.3 (B:) Phycocyanin beta subunit {Red alga (Cyanidium caldarium) [TaxId: 2771]}
mldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralf
seqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssilddrclnglretyqal
gvpgasvavgiekmkdsaiaiandpsgittgdcsalmaevgtyfdraatavq
SCOPe Domain Coordinates for d1phnb_:
Click to download the PDB-style file with coordinates for d1phnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1phnb_:
- d1phnb_ first appeared (with stable ids) in SCOP 1.55
- d1phnb_ appears in SCOPe 2.05
- d1phnb_ appears in SCOPe 2.07
- d1phnb_ appears in the current release, SCOPe 2.08
View in 3D
