Lineage for d1pfca_ (1pfc A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028025Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2028026Species Guinea pig (Cavia porcellus) [TaxId:10141] [49123] (1 PDB entry)
  8. 2028027Domain d1pfca_: 1pfc A: [21546]
    CH-gamma-3 domain only

Details for d1pfca_

PDB Entry: 1pfc (more details), 3.12 Å

PDB Description: molecular-replacement structure of guinea pig igg1 p*fc(prime) refined at 3.1 angstroms resolution
PDB Compounds: (A:) igg1 pfc' fc

SCOPe Domain Sequences for d1pfca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]}
rtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykntp
pvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg

SCOPe Domain Coordinates for d1pfca_:

Click to download the PDB-style file with coordinates for d1pfca_.
(The format of our PDB-style files is described here.)

Timeline for d1pfca_: