Lineage for d1peyc_ (1pey C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356044Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1356260Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 1356261Species Bacillus subtilis [TaxId:1423] [52189] (9 PDB entries)
    Uniprot P06628
  8. 1356266Domain d1peyc_: 1pey C: [104139]
    complexed with mn

Details for d1peyc_

PDB Entry: 1pey (more details), 2.25 Å

PDB Description: crystal structure of the response regulator spo0f complexed with mn2+
PDB Compounds: (C:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d1peyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1peyc_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOPe Domain Coordinates for d1peyc_:

Click to download the PDB-style file with coordinates for d1peyc_.
(The format of our PDB-style files is described here.)

Timeline for d1peyc_: