Lineage for d1pdaa1 (1pda A:3-219)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
has additional insertions and/or extensions that are not grouped together
Protein Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain [53854] (1 species) Species Escherichia coli [TaxId:562] [53855] (5 PDB entries) 
Domain d1pdaa1: 1pda A:3-219 [35751]
Other proteins in same PDB: d1pdaa2
complexed with acy, dpm
Details for d1pdaa1
PDB Entry: 1pda (more details), 1.76 Å
PDB Description: structure of porphobilinogen deaminase reveals a flexible multidomain polymerase with a single catalytic site
PDB Compounds: (A:) porphobilinogen deaminaseSCOPe Domain Sequences for d1pdaa1:
Sequence, based on SEQRES records: (download)
>d1pdaa1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]}
dnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdvildtplakvggkglf
vkelevallenradiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalpag
sivgtsslrrqcqlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlglesr
iraalppeislpavgqgavgiecrlddsrtrellaal
Sequence, based on observed residues (ATOM records): (download)
>d1pdaa1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]}
dnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdvigkglfvkelevall
enradiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalpagsivgtsslr
rqcqlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlglesriraalppei
slpavgqgavgiecrlddsrtrellaal
SCOPe Domain Coordinates for d1pdaa1:
Click to download the PDB-style file with coordinates for d1pdaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pdaa1:
- d1pdaa1 first appeared (with stable ids) in SCOP 1.55, called d1pda_1
- d1pdaa1 appears in SCOPe 2.07
View in 3D
