Lineage for d1pbxb_ (1pbx B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Hemoglobin, beta-chain [46500] (24 species) 
Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries) 
Domain d1pbxb_: 1pbx B: [15582]
Other proteins in same PDB: d1pbxa_
complexed with cmo, hem
Details for d1pbxb_
PDB Entry: 1pbx (more details), 2.5 Å
PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative
PDB Compounds: (B:) hemoglobin (carbonmonoxy) (beta chain)SCOPe Domain Sequences for d1pbxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh
SCOPe Domain Coordinates for d1pbxb_:
Click to download the PDB-style file with coordinates for d1pbxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pbxb_:
- d1pbxb_ first appeared (with stable ids) in SCOP 1.55
- d1pbxb_ appears in SCOPe 2.04
- d1pbxb_ appears in SCOPe 2.06
- d1pbxb_ appears in the current release, SCOPe 2.08
View in 3D
