Lineage for d1p9qc3 (1p9q C:162-234)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653322Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 1653404Family d.58.11.3: Hypothetical protein AF0491, C-terminal domain [110976] (1 protein)
  6. 1653405Protein Hypothetical protein AF0491, C-terminal domain [110977] (1 species)
  7. 1653406Species Archaeoglobus fulgidus [TaxId:2234] [110978] (2 PDB entries)
    Uniprot O29759
  8. 1653408Domain d1p9qc3: 1p9q C:162-234 [104095]
    Other proteins in same PDB: d1p9qc1, d1p9qc2
    Structural genomics target

Details for d1p9qc3

PDB Entry: 1p9q (more details), 2 Å

PDB Description: structure of a hypothetical protein af0491 from archaeoglobus fulgidus
PDB Compounds: (C:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1p9qc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9qc3 d.58.11.3 (C:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
eemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmdllgkva
kgealtkvlrrig

SCOPe Domain Coordinates for d1p9qc3:

Click to download the PDB-style file with coordinates for d1p9qc3.
(The format of our PDB-style files is described here.)

Timeline for d1p9qc3: