Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries) |
Domain d1p98a_: 1p98 A: [94383] |
PDB Entry: 1p98 (more details)
SCOPe Domain Sequences for d1p98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p98a_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp irdyrideknfvvvmvtk
Timeline for d1p98a_: