Lineage for d1p8la2 (1p8l A:2-189)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamilies
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) 
has a circularly permuted topology
Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)
automatically mapped to Pfam PF01068Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species) Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries) 
Domain d1p8la2: 1p8l A:2-189 [94364]
Other proteins in same PDB: d1p8la1
complexed with amp
Details for d1p8la2
PDB Entry: 1p8l (more details), 2.95 Å
PDB Description: New Crystal Structure of Chlorella Virus DNA Ligase-Adenylate
PDB Compounds: (A:) PBCV-1 DNA ligaseSCOPe Domain Sequences for d1p8la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8la2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
aitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
gillkmkq
SCOPe Domain Coordinates for d1p8la2:
Click to download the PDB-style file with coordinates for d1p8la2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p8la2:
- d1p8la2 first appeared in SCOP 1.67
- d1p8la2 appears in SCOPe 2.07
View in 3D
