Lineage for d1p8da_ (1p8d A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) 
Protein Oxysterols receptor LXR-beta [89149] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89150] (6 PDB entries)
Uniprot P55055 219-461
Domain d1p8da_: 1p8d A: [87941]
complexed with a co-activator peptide, chains C and D
complexed with co1
Details for d1p8da_
PDB Entry: 1p8d (more details), 2.8 Å
PDB Description: x-ray crystal structure of lxr ligand binding domain with 24(s),25- epoxycholesterol
PDB Compounds: (A:) oxysterols receptor lxr-betaSCOPe Domain Sequences for d1p8da_:
Sequence, based on SEQRES records: (download)
>d1p8da_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaii
svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk
ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq
pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
dvhe
Sequence, based on observed residues (ATOM records): (download)
>d1p8da_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplqsrdarqqrfahftelaiisvqe
ivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfh
raglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyve
allsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdvhe
SCOPe Domain Coordinates for d1p8da_:
Click to download the PDB-style file with coordinates for d1p8da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p8da_:
- d1p8da_ first appeared in SCOP 1.65
- d1p8da_ appears in SCOPe 2.04
- d1p8da_ appears in SCOPe 2.06
- d1p8da_ appears in the current release, SCOPe 2.08
View in 3D
