Lineage for d1p4ob_ (1p4o B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Insulin-like growth factor 1 receptor [69825] (1 species)
PTK group; InsR subfamily; membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries) 
Domain d1p4ob_: 1p4o B: [87776]
Details for d1p4ob_
PDB Entry: 1p4o (more details), 1.5 Å
PDB Description: structure of apo unactivated igf-1r kinase domain at 1.5a resolution.
PDB Compounds: (B:) Insulin-like growth factor I receptor proteinSCOPe Domain Sequences for d1p4ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p4ob_ d.144.1.7 (B:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
npeyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvn
eaasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrp
amannpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgm
trdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqgl
sneqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfre
vsfyyseenklpep
SCOPe Domain Coordinates for d1p4ob_:
Click to download the PDB-style file with coordinates for d1p4ob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p4ob_:
- d1p4ob_ first appeared in SCOP 1.65
- d1p4ob_ appears in SCOPe 2.05
- d1p4ob_ appears in SCOPe 2.07
- d1p4ob_ appears in the current release, SCOPe 2.08
View in 3D
