Lineage for d1p4bl_ (1p4b L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741706Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. 2741725Domain d1p4bl_: 1p4b L: [94099]
    Other proteins in same PDB: d1p4bh_
    part of anti-GCN4 peptide scFv

Details for d1p4bl_

PDB Entry: 1p4b (more details), 2.35 Å

PDB Description: Three-Dimensional Structure Of a Single Chain Fv Fragment Complexed With The peptide GCN4(7P-14P).
PDB Compounds: (L:) Antibody Variable light chain

SCOPe Domain Sequences for d1p4bl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4bl_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
adavvtqesalttspgetvtltcrsstgavttsnyaswvqekpdhlftgliggtnnrapg
vparfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOPe Domain Coordinates for d1p4bl_:

Click to download the PDB-style file with coordinates for d1p4bl_.
(The format of our PDB-style files is described here.)

Timeline for d1p4bl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p4bh_