Lineage for d1p1ta_ (1p1t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951889Protein Cleavage stimulation factor, 64 kda subunit [102983] (1 species)
  7. 2951890Species Human (Homo sapiens) [TaxId:9606] [102984] (3 PDB entries)
  8. 2951893Domain d1p1ta_: 1p1t A: [93899]
    N-terminal RBD

Details for d1p1ta_

PDB Entry: 1p1t (more details)

PDB Description: nmr structure of the n-terminal rrm domain of cleavage stimulation factor 64 kda subunit
PDB Compounds: (A:) Cleavage stimulation factor, 64 kDa subunit

SCOPe Domain Sequences for d1p1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}
dpavdrslrsvfvgnipyeateeqlkdifsevgpvvsfrlvydretgkpkgygfceyqdq
etalsamrnlngrefsgralrvdnaaseknkeelkslgtgapvi

SCOPe Domain Coordinates for d1p1ta_:

Click to download the PDB-style file with coordinates for d1p1ta_.
(The format of our PDB-style files is described here.)

Timeline for d1p1ta_: