Lineage for d1ox3a_ (1ox3 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040382Superfamily h.1.17: Fibritin [58046] (1 family) (S)
  5. 3040383Family h.1.17.1: Fibritin [58047] (1 protein)
  6. 3040384Protein Fibritin [58048] (2 species)
    biological unit: trimer; fragmented coiled coil capped with beta-hairpin triplet
  7. 3040385Species Bacteriophage T4 [TaxId:10665] [58049] (7 PDB entries)
    Uniprot P10104
  8. 3040403Domain d1ox3a_: 1ox3 A: [93668]
    mini-fibritin mutant
    beta-hairpin triplet (foldon) only; no coiled-coil structure

Details for d1ox3a_

PDB Entry: 1ox3 (more details), 2 Å

PDB Description: crystal structure of mini-fibritin
PDB Compounds: (A:) fibritin

SCOPe Domain Sequences for d1ox3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox3a_ h.1.17.1 (A:) Fibritin {Bacteriophage T4 [TaxId: 10665]}
divlndlpfvdgppaegqsriswikngeeilgadtqygsegsmnrptvsvlrnvevldkn
igilktsletansdiktiqeagyipeaprdgqayvrkdgewvllstfl

SCOPe Domain Coordinates for d1ox3a_:

Click to download the PDB-style file with coordinates for d1ox3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ox3a_: