SCOPe 2.03: Domain d1owrm1: 1owr M:576-678

Lineage for d1owrm1 (1owr M:576-678)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (24 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
subgroup of the larger IPT/TIG domain family
Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
Domain d1owrm1: 1owr M:576-678 [93657]
Other proteins in same PDB: d1owrm2, d1owrn2, d1owrp2, d1owrq2
protein/DNA complex

Details for d1owrm1

PDB Description: crystal structure of human nfat1 bound monomerically to dna

PDB Compounds: (M:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1owrm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owrm1 b.1.18.1 (M:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOPe Domain Coordinates for d1owrm1:

Click to download the PDB-style file with coordinates for d1owrm1.
(The format of our PDB-style files is described here.)

Timeline for d1owrm1: